Lineage for d1zwxa1 (1zwx A:41-333)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548643Family d.151.1.3: Sphingomyelin phosphodiesterase-like [143902] (2 proteins)
    part of Pfam PF03372
  6. 2548644Protein Sphingomyelin phosphodiesterase C [143903] (2 species)
  7. 2548647Species Listeria ivanovii [TaxId:1638] [143905] (1 PDB entry)
    Uniprot Q9RLV9 41-333
  8. 2548648Domain d1zwxa1: 1zwx A:41-333 [125752]
    complexed with gol, po4

Details for d1zwxa1

PDB Entry: 1zwx (more details), 1.9 Å

PDB Description: Crystal Structure of SmcL
PDB Compounds: (A:) sphingomyelinase-c

SCOPe Domain Sequences for d1zwxa1:

Sequence, based on SEQRES records: (download)

>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]}
ypgnfkitshnvylfsrniypnwgqmhradliaqadymknndvvilneafdtsashrlln
nlremyphqtpvigrskhgwdktegnysnfaledggvavvsqwpiveksqhifqrgggad
rlsnkgfayvkimkngkpyhiigthtqaddsliskdtsrairaeqmqeiqtfiakknipk
deiifiggdlnvnygtdeyhdmlkllnvsspanfngqmatwdpttnsmlkesypkaapey
ldyifvengharphswhnkvlhtkspqwsvkswfktytyqdfsdhypvvgftd

Sequence, based on observed residues (ATOM records): (download)

>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]}
ypgnfkitshnvylfsrniypnwgqmhradliaqadymknndvvilneafdtsashrlln
nlremyphqtpvigrskhgwdktegaledggvavvsqwpiveksqhifqrgggadrlsnk
gfayvkimkngkpyhiigthtqaddsliskdtsrairaeqmqeiqtfiakknipkdeiif
iggdlnvnygtdeyhdmlkllnvsspanfngqmatwdpttnsmlkesypkaapeyldyif
vengharphswhnkvlhtkspqwsvkswfktytyqdfsdhypvvgftd

SCOPe Domain Coordinates for d1zwxa1:

Click to download the PDB-style file with coordinates for d1zwxa1.
(The format of our PDB-style files is described here.)

Timeline for d1zwxa1: