Lineage for d1zwwa1 (1zww A:27-246)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020027Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2020028Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2020029Family a.238.1.1: BAR domain [103658] (4 proteins)
    sensor of membrane curvature
  6. 2020036Protein Endophilin-1 [140699] (3 species)
    SH3-containing GRB2-like protein 2
  7. 2020041Species Mouse (Mus musculus) [TaxId:10090] [140702] (1 PDB entry)
    Uniprot Q62420 27-246
  8. 2020042Domain d1zwwa1: 1zww A:27-246 [125750]
    complexed with cd

Details for d1zwwa1

PDB Entry: 1zww (more details), 2.3 Å

PDB Description: Crystal structure of endophilin-A1 BAR domain
PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d1zwwa1:

Sequence, based on SEQRES records: (download)

>d1zwwa1 a.238.1.1 (A:27-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
tkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmintmskirgqekgpgy
pqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnl
hdkdlreiqhhlkklegrrldfgykkkrqgkipdeelrqalekfdeskeiaessmfnlle
mdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirq

Sequence, based on observed residues (ATOM records): (download)

>d1zwwa1 a.238.1.1 (A:27-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
tkldddfkemerkvdvtsravmeimtktieylqpnpasrpqaeallaeamlkfgrelgdd
cnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrld
fgykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhk
qavqilqqvtvrleerirq

SCOPe Domain Coordinates for d1zwwa1:

Click to download the PDB-style file with coordinates for d1zwwa1.
(The format of our PDB-style files is described here.)

Timeline for d1zwwa1: