SCOPe 2.05: Domain d1zwwa1: 1zww A:27-246

Lineage for d1zwwa1 (1zww A:27-246)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (4 proteins)
   sensor of membrane curvature

6. Protein Endophilin-1 [140699] (3 species)
   SH3-containing GRB2-like protein 2

7. Species Mouse (Mus musculus) [TaxId:10090] [140702] (1 PDB entry)
   Uniprot Q62420 27-246

8. Domain d1zwwa1: 1zww A:27-246 [125750]
   complexed with cd

Details for d1zwwa1

PDB Entry: 1zww, 2.3 Å

PDB Description: Crystal structure of endophilin-A1 BAR domain

PDB Compounds: (A:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d1zwwa1:

Sequence, based on SEQRES records:

>d1zwwa1 a.238.1.1 (A:27-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
tkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmintmskirgqekgpgy
pqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnl
hdkdlreiqhhlkklegrrldfgykkkrqgkipdeelrqalekfdeskeiaessmfnlle
mdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirq

Sequence, based on observed residues (ATOM records):

>d1zwwa1 a.238.1.1 (A:27-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
tkldddfkemerkvdvtsravmeimtktieylqpnpasrpqaeallaeamlkfgrelgdd
cnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrld
fgykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhk
qavqilqqvtvrleerirq

Timeline for d1zwwa1:

• d1zwwa1 first appeared in SCOP 1.73
  
• d1zwwa1 appears in SCOPe 2.04
  
• d1zwwa1 appears in SCOPe 2.06
  
• d1zwwa1 appears in the current release, SCOPe 2.08