![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) ![]() core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
![]() | Family a.238.1.1: BAR domain [103658] (4 proteins) sensor of membrane curvature |
![]() | Protein Endophilin-1 [140699] (3 species) SH3-containing GRB2-like protein 2 |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140702] (1 PDB entry) Uniprot Q62420 27-246 |
![]() | Domain d1zwwa1: 1zww A:27-246 [125750] complexed with cd |
PDB Entry: 1zww (more details), 2.3 Å
SCOPe Domain Sequences for d1zwwa1:
Sequence, based on SEQRES records: (download)
>d1zwwa1 a.238.1.1 (A:27-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]} tkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmintmskirgqekgpgy pqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnl hdkdlreiqhhlkklegrrldfgykkkrqgkipdeelrqalekfdeskeiaessmfnlle mdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirq
>d1zwwa1 a.238.1.1 (A:27-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]} tkldddfkemerkvdvtsravmeimtktieylqpnpasrpqaeallaeamlkfgrelgdd cnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrld fgykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhk qavqilqqvtvrleerirq
Timeline for d1zwwa1: