Lineage for d1zwna1 (1zwn A:1-164)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 714012Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 714013Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 714660Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 714666Protein Phage T4 lysozyme [53982] (1 species)
  7. 714667Species Bacteriophage T4 [TaxId:10665] [53983] (431 PDB entries)
    many mutant structures
  8. 714830Domain d1zwna1: 1zwn A:1-164 [125748]
    automatically matched to d1jtma_
    complexed with azi, cl, hed, r1b; mutant

Details for d1zwna1

PDB Entry: 1zwn (more details), 1.8 Å

PDB Description: Crystal structure of spin labeled T4 Lysozyme (V131R1B)
PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d1zwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwna1 d.2.1.3 (A:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaacnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d1zwna1:

Click to download the PDB-style file with coordinates for d1zwna1.
(The format of our PDB-style files is described here.)

Timeline for d1zwna1: