Lineage for d1zwkb_ (1zwk B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465114Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 2465123Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. 2465153Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)
    Uniprot Q9I509 3-198! Uniprot Q9I509 4-196
  8. 2465157Domain d1zwkb_: 1zwk B: [125746]
    automated match to d2a5la1
    complexed with po4

Details for d1zwkb_

PDB Entry: 1zwk (more details), 2.6 Å

PDB Description: structure of wrba from pseudomonas aeruginosa
PDB Compounds: (B:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1zwkb_:

Sequence, based on SEQRES records: (download)

>d1zwkb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyat
ledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqe
ttqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcr
algkrlaetagkl

Sequence, based on observed residues (ATOM records): (download)

>d1zwkb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavstegalyatledlkncagla
lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll
hhgmlvlgiptpygashfagadgkrsldeheltlcralgkrlaetagkl

SCOPe Domain Coordinates for d1zwkb_:

Click to download the PDB-style file with coordinates for d1zwkb_.
(The format of our PDB-style files is described here.)

Timeline for d1zwkb_: