SCOP 1.73: Domain d1zwkb1: 1zwk B:4-196

Lineage for d1zwkb1 (1zwk B:4-196)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.8: WrbA-like [117474] (2 proteins)

6. Protein Trp repressor binding protein WrbA [117475] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)

8. Domain d1zwkb1: 1zwk B:4-196 [125746]
   automatically matched to 1ZWK A:4-196
   complexed with po4

Details for d1zwkb1

PDB Entry: 1zwk, 2.6 Å

PDB Description: structure of wrba from pseudomonas aeruginosa

PDB Compounds: (B:) Trp repressor binding protein WrbA

SCOP Domain Sequences for d1zwkb1:

Sequence, based on SEQRES records:

>d1zwkb1 c.23.5.8 (B:4-196) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyat
ledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqe
ttqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcr
algkrlaetagkl

Sequence, based on observed residues (ATOM records):

>d1zwkb1 c.23.5.8 (B:4-196) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavstegalyatledlkncagla
lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll
hhgmlvlgiptpygashfagadgkrsldeheltlcralgkrlaetagkl

Timeline for d1zwkb1:

• d1zwkb1 is new in SCOP 1.73
  
• d1zwkb1 appears in SCOP 1.75
  
• d1zwkb1 appears in the current release, SCOPe 2.08, called d1zwkb_