![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
![]() | Family c.23.5.8: WrbA-like [117474] (2 proteins) |
![]() | Protein Trp repressor binding protein WrbA [117475] (2 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries) |
![]() | Domain d1zwkb1: 1zwk B:4-196 [125746] automatically matched to 1ZWK A:4-196 complexed with po4 |
PDB Entry: 1zwk (more details), 2.6 Å
SCOP Domain Sequences for d1zwkb1:
Sequence, based on SEQRES records: (download)
>d1zwkb1 c.23.5.8 (B:4-196) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} pyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyat ledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqe ttqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcr algkrlaetagkl
>d1zwkb1 c.23.5.8 (B:4-196) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} pyilvlyysrhgataemarqiargveqggfearvrtvpavstegalyatledlkncagla lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll hhgmlvlgiptpygashfagadgkrsldeheltlcralgkrlaetagkl
Timeline for d1zwkb1: