Domain d1zwkb_: 1zwk B:

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d1zwkb_ (1zwk B:)

Root: SCOP 1.75B
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families)
Family c.23.5.8: WrbA-like [117474] (3 protein domains)
Protein Trp repressor binding protein WrbA [117475] (3 species)
Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)
Uniprot Q9I509 3-198! Uniprot Q9I509 4-196
Domain d1zwkb_: 1zwk B: [125746]
automated match to d2a5la1
complexed with po4

Details for d1zwkb_

PDB Entry: 1zwk (more details)
PDB Description: structure of wrba from pseudomonas aeruginosa
PDB Compounds: (B:) Trp repressor binding protein WrbA

SCOP Domain Sequences for d1zwkb_:
Sequence, based on SEQRES records: (download)

>d1zwkb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} pyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyat ledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqe ttqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcr algkrlaetagkl

Sequence, based on observed residues (ATOM records): (download)

>d1zwkb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} pyilvlyysrhgataemarqiargveqggfearvrtvpavstegalyatledlkncagla lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll hhgmlvlgiptpygashfagadgkrsldeheltlcralgkrlaetagkl

SCOP Domain Coordinates for d1zwkb_:

Click to download the PDB-style file with coordinates for d1zwkb_.
(The format of our PDB-style files is described here.)

Timeline for d1zwkb_:
d1zwkb_ appears in SCOP 1.75A

d1zwkb_
(click for larger image)

d1zwkb_ in context of chain

d1zwkb_ in context of PDB
Domains from other chains:
d1zwka1