Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.8: WrbA-like [117474] (3 proteins) |
Protein Trp repressor binding protein WrbA [117475] (4 species) |
Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries) Uniprot Q9I509 3-198! Uniprot Q9I509 4-196 |
Domain d1zwkb_: 1zwk B: [125746] automated match to d2a5la1 complexed with po4 |
PDB Entry: 1zwk (more details), 2.6 Å
SCOPe Domain Sequences for d1zwkb_:
Sequence, based on SEQRES records: (download)
>d1zwkb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} pyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyat ledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqe ttqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcr algkrlaetagkl
>d1zwkb_ c.23.5.8 (B:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} pyilvlyysrhgataemarqiargveqggfearvrtvpavstegalyatledlkncagla lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll hhgmlvlgiptpygashfagadgkrsldeheltlcralgkrlaetagkl
Timeline for d1zwkb_: