SCOPe 2.01: Domain d1zwjb2: 1zwj B:196-350

Lineage for d1zwjb2 (1zwj B:196-350)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
   duplication: consists of 2 HIT-like motifs
   binds zinc and iron ions

6. Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries)
   Uniprot Q9FK51

8. Domain d1zwjb2: 1zwj B:196-350 [125744]
   automatically matched to d1vkva2
   complexed with zn

Details for d1zwjb2

PDB Entry: 1zwj, 2.3 Å

PDB Description: x-ray structure of galt-like protein from arabidopsis thaliana at5g18200

PDB Compounds: (B:) putative galactose-1-phosphate uridyl transferase

SCOPe Domain Sequences for d1zwjb2:

Sequence; same for both SEQRES and ATOM records:

>d1zwjb2 d.13.1.2 (B:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh
sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi
vpqlsgvggfeigtgcyinpvfpedvakvmrevsl

Timeline for d1zwjb2:

• d1zwjb2 first appeared in SCOP 1.73
  
• d1zwjb2 appears in SCOP 1.75
  
• d1zwjb2 appears in SCOPe 2.02
  
• d1zwjb2 appears in the current release, SCOPe 2.08