Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (5 families) |
Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein) duplication: consists of 2 HIT-like motifs binds zinc and iron ions |
Protein Galactose-1-phosphate uridylyltransferase [54208] (2 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries) Uniprot Q9FK51 |
Domain d1zwjb2: 1zwj B:196-350 [125744] automatically matched to d1vkva2 complexed with zn |
PDB Entry: 1zwj (more details), 2.3 Å
SCOPe Domain Sequences for d1zwjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zwjb2 d.13.1.2 (B:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi vpqlsgvggfeigtgcyinpvfpedvakvmrevsl
Timeline for d1zwjb2: