Lineage for d1zwjb2 (1zwj B:196-350)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929896Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 2929897Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)
  7. 2929930Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries)
    Uniprot Q9FK51
  8. 2929950Domain d1zwjb2: 1zwj B:196-350 [125744]
    automatically matched to d1vkva2
    complexed with zn

Details for d1zwjb2

PDB Entry: 1zwj (more details), 2.3 Å

PDB Description: x-ray structure of galt-like protein from arabidopsis thaliana at5g18200
PDB Compounds: (B:) putative galactose-1-phosphate uridyl transferase

SCOPe Domain Sequences for d1zwjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwjb2 d.13.1.2 (B:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh
sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi
vpqlsgvggfeigtgcyinpvfpedvakvmrevsl

SCOPe Domain Coordinates for d1zwjb2:

Click to download the PDB-style file with coordinates for d1zwjb2.
(The format of our PDB-style files is described here.)

Timeline for d1zwjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zwjb1