Lineage for d1zwic2 (1zwi C:22-123)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252691Protein Potassium channel protein [56901] (2 species)
  7. 2252736Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)
  8. 2252744Domain d1zwic2: 1zwi C:22-123 [125740]
    Other proteins in same PDB: d1zwia1, d1zwia2, d1zwib1, d1zwib2, d1zwic3
    automated match to d1k4cc_
    complexed with dga, f09, k; mutant

Details for d1zwic2

PDB Entry: 1zwi (more details), 2.5 Å

PDB Description: Structure of mutant KcsA potassium channel
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1zwic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwic2 f.14.1.1 (C:22-123) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrg

SCOPe Domain Coordinates for d1zwic2:

Click to download the PDB-style file with coordinates for d1zwic2.
(The format of our PDB-style files is described here.)

Timeline for d1zwic2: