SCOPe 2.03: Domain d1zwic_: 1zwi C:

Lineage for d1zwic_ (1zwi C:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (17 PDB entries)

8. Domain d1zwic_: 1zwi C: [125740]
   Other proteins in same PDB: d1zwia1, d1zwia2, d1zwib1, d1zwib2
   automated match to d1k4cc_
   complexed with dga, f09, k; mutant

Details for d1zwic_

PDB Entry: 1zwi, 2.5 Å

PDB Description: structure of mutant kcsa potassium channel

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1zwic_:

Sequence; same for both SEQRES and ATOM records:

>d1zwic_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrga

Timeline for d1zwic_:

• d1zwic_ first appeared in SCOP 1.73, called d1zwic1
  
• d1zwic_ appears in SCOPe 2.02
  
• d1zwic_ appears in SCOPe 2.04
  
• d1zwic_ appears in the current release, SCOPe 2.08, called d1zwic2