Lineage for d1zvvg2 (1zvv G:60-332)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710422Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 710423Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 710424Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 710464Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)
  7. 710465Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)
  8. 710494Domain d1zvvg2: 1zvv G:60-332 [125732]
    Other proteins in same PDB: d1zvva1, d1zvvb1, d1zvvg1
    automatically matched to 1ZVV A:60-332
    complexed with iod; mutant

Details for d1zvvg2

PDB Entry: 1zvv (more details), 2.98 Å

PDB Description: Crystal structure of a ccpa-crh-dna complex
PDB Compounds: (G:) Glucose-resistance amylase regulator

SCOP Domain Sequences for d1zvvg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvvg2 c.93.1.1 (G:60-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivelphriefrqstk

SCOP Domain Coordinates for d1zvvg2:

Click to download the PDB-style file with coordinates for d1zvvg2.
(The format of our PDB-style files is described here.)

Timeline for d1zvvg2: