Lineage for d1zvvb2 (1zvv B:60-332)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008365Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1008366Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1008367Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1008413Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species)
  7. 1008414Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. 1008442Domain d1zvvb2: 1zvv B:60-332 [125730]
    Other proteins in same PDB: d1zvva1, d1zvvb1, d1zvvg1, d1zvvj1, d1zvvp_, d1zvvw_
    automatically matched to 1ZVV A:60-332
    protein/DNA complex; complexed with iod

Details for d1zvvb2

PDB Entry: 1zvv (more details), 2.98 Å

PDB Description: Crystal structure of a ccpa-crh-dna complex
PDB Compounds: (B:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1zvvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvvb2 c.93.1.1 (B:60-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivelphriefrqstk

SCOPe Domain Coordinates for d1zvvb2:

Click to download the PDB-style file with coordinates for d1zvvb2.
(The format of our PDB-style files is described here.)

Timeline for d1zvvb2: