![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins) |
![]() | Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (1 species) |
![]() | Species Bacillus megaterium [TaxId:1404] [117741] (9 PDB entries) Uniprot P46828 58-322 Uniprot P46828 Uniprot P46828 58-322 ! Uniprot P46828 |
![]() | Domain d1zvva2: 1zvv A:60-332 [125728] Other proteins in same PDB: d1zvva1, d1zvvb1, d1zvvg1, d1zvvj1, d1zvvp1, d1zvvw1 complexed with iod; mutant |
PDB Entry: 1zvv (more details), 2.98 Å
SCOP Domain Sequences for d1zvva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvva2 c.93.1.1 (A:60-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} tttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdg iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga vamrlltkymnketvdssivelphriefrqstk
Timeline for d1zvva2: