SCOPe 2.01: Domain d1zvra2: 1zvr A:199-585

Lineage for d1zvra2 (1zvr A:199-585)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.3: Myotubularin-like phosphatases [102422] (1 protein)
   common fold is decorated with additional structures

6. Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102424] (4 PDB entries)

8. Domain d1zvra2: 1zvr A:199-585 [125724]
   Other proteins in same PDB: d1zvra1
   automatically matched to d1lw3a2
   complexed with 3pi, edo

Details for d1zvra2

PDB Entry: 1zvr, 1.98 Å

PDB Description: crystal structure of mtmr2 in complex with phosphatidylinositol 3,5- bisphosphate

PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d1zvra2:

Sequence; same for both SEQRES and ATOM records:

>d1zvra2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv
asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi
fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth
wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy
yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf
efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs
ysnhvlypvasmrhlelwvgyyirwnp

Timeline for d1zvra2:

• d1zvra2 first appeared in SCOP 1.73
  
• d1zvra2 appears in SCOP 1.75
  
• d1zvra2 appears in SCOPe 2.02
  
• d1zvra2 appears in the current release, SCOPe 2.08