Lineage for d1zvpd2 (1zvp D:68-131)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2561057Family d.58.18.9: VC0802-like [143387] (1 protein)
    duplication: tandem repeat of two ACT-like domains; contains circular permutation (the C-terminal strand replacement with extra N-terminal strand); dimerizes with the formation of orthogonally packed intersubunit beta-sheets
  6. 2561058Protein Hypothetical protein VC0802 [143388] (1 species)
  7. 2561059Species Vibrio cholerae [TaxId:666] [143389] (1 PDB entry)
    Uniprot Q9KTT6 2-67! Uniprot Q9KTT6 68-131
  8. 2561067Domain d1zvpd2: 1zvp D:68-131 [125721]
    Other proteins in same PDB: d1zvpc3
    automated match to d1zvpa2

Details for d1zvpd2

PDB Entry: 1zvp (more details), 2.2 Å

PDB Description: Crystal Structure of a Protein of Unknown Function VC0802 from Vibrio cholerae, Possible Transport Protein
PDB Compounds: (D:) hypothetical protein VC0802

SCOPe Domain Sequences for d1zvpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvpd2 d.58.18.9 (D:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]}
alfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkekaqqalqalg
efaq

SCOPe Domain Coordinates for d1zvpd2:

Click to download the PDB-style file with coordinates for d1zvpd2.
(The format of our PDB-style files is described here.)

Timeline for d1zvpd2: