SCOP 1.73: Domain d1zvpd2: 1zvp D:68-131

Lineage for d1zvpd2 (1zvp D:68-131)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (12 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.9: VC0802-like [143387] (1 protein)
   duplication: tandem repeat of two ACT-like domains; contains circular permutation (the C-terminal strand replacement with extra N-terminal strand); dimerizes with the formation of orthogonally packed intersubunit beta-sheets

6. Protein Hypothetical protein VC0802 [143388] (1 species)

7. Species Vibrio cholerae [TaxId:666] [143389] (1 PDB entry)

8. Domain d1zvpd2: 1zvp D:68-131 [125721]
   automatically matched to 1ZVP A:68-131

Details for d1zvpd2

PDB Entry: 1zvp, 2.2 Å

PDB Description: Crystal Structure of a Protein of Unknown Function VC0802 from Vibrio cholerae, Possible Transport Protein

PDB Compounds: (D:) hypothetical protein VC0802

SCOP Domain Sequences for d1zvpd2:

Sequence; same for both SEQRES and ATOM records:

>d1zvpd2 d.58.18.9 (D:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]}
alfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkekaqqalqalg
efaq

Timeline for d1zvpd2:

• d1zvpd2 is new in SCOP 1.73
  
• d1zvpd2 appears in SCOP 1.75
  
• d1zvpd2 appears in the current release, SCOPe 2.08