| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (14 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.9: VC0802-like [143387] (1 protein) duplication: tandem repeat of two ACT-like domains; contains circular permutation (the C-terminal strand replacement with extra N-terminal strand); dimerizes with the formation of orthogonally packed intersubunit beta-sheets |
| Protein Hypothetical protein VC0802 [143388] (1 species) |
| Species Vibrio cholerae [TaxId:666] [143389] (1 PDB entry) Uniprot Q9KTT6 2-67! Uniprot Q9KTT6 68-131 |
| Domain d1zvpb2: 1zvp B:68-131 [125717] automatically matched to 1ZVP A:68-131 |
PDB Entry: 1zvp (more details), 2.2 Å
SCOP Domain Sequences for d1zvpb2:
Sequence, based on SEQRES records: (download)
>d1zvpb2 d.58.18.9 (B:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]}
alfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkekaqqalqalg
efaq
>d1zvpb2 d.58.18.9 (B:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]}
alfslitltvhleavgltaafatklaehgisanviagyyhdhifvqkekaqqalqalgef
aq
Timeline for d1zvpb2: