![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.9: VC0802-like [143387] (1 protein) duplication: tandem repeat of two ACT-like domains; contains circular permutation (the C-terminal strand replacement with extra N-terminal strand); dimerizes with the formation of orthogonally packed intersubunit beta-sheets |
![]() | Protein Hypothetical protein VC0802 [143388] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [143389] (1 PDB entry) Uniprot Q9KTT6 2-67! Uniprot Q9KTT6 68-131 |
![]() | Domain d1zvpb2: 1zvp B:68-131 [125717] Other proteins in same PDB: d1zvpc3 automated match to d1zvpa2 |
PDB Entry: 1zvp (more details), 2.2 Å
SCOPe Domain Sequences for d1zvpb2:
Sequence, based on SEQRES records: (download)
>d1zvpb2 d.58.18.9 (B:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]} alfslitltvhssleavgltaafatklaehgisanviagyyhdhifvqkekaqqalqalg efaq
>d1zvpb2 d.58.18.9 (B:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]} alfslitltvhleavgltaafatklaehgisanviagyyhdhifvqkekaqqalqalgef aq
Timeline for d1zvpb2: