SCOPe 2.06: Domain d1zvpb1: 1zvp B:2-67

Lineage for d1zvpb1 (1zvp B:2-67)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.9: VC0802-like [143387] (1 protein)
   duplication: tandem repeat of two ACT-like domains; contains circular permutation (the C-terminal strand replacement with extra N-terminal strand); dimerizes with the formation of orthogonally packed intersubunit beta-sheets

6. Protein Hypothetical protein VC0802 [143388] (1 species)

7. Species Vibrio cholerae [TaxId:666] [143389] (1 PDB entry)
   Uniprot Q9KTT6 2-67! Uniprot Q9KTT6 68-131

8. Domain d1zvpb1: 1zvp B:2-67 [125716]
   Other proteins in same PDB: d1zvpc3
   automated match to d1zvpa1

Details for d1zvpb1

PDB Entry: 1zvp, 2.2 Å

PDB Description: Crystal Structure of a Protein of Unknown Function VC0802 from Vibrio cholerae, Possible Transport Protein

PDB Compounds: (B:) hypothetical protein VC0802

SCOPe Domain Sequences for d1zvpb1:

Sequence; same for both SEQRES and ATOM records:

>d1zvpb1 d.58.18.9 (B:2-67) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]}
sgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaekaqq
agless

Timeline for d1zvpb1:

• d1zvpb1 first appeared in SCOP 1.73
  
• d1zvpb1 appears in SCOPe 2.05
  
• d1zvpb1 appears in SCOPe 2.07
  
• d1zvpb1 appears in the current release, SCOPe 2.08