Lineage for d1zvpa1 (1zvp A:2-67)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954197Family d.58.18.9: VC0802-like [143387] (1 protein)
    duplication: tandem repeat of two ACT-like domains; contains circular permutation (the C-terminal strand replacement with extra N-terminal strand); dimerizes with the formation of orthogonally packed intersubunit beta-sheets
  6. 2954198Protein Hypothetical protein VC0802 [143388] (1 species)
  7. 2954199Species Vibrio cholerae [TaxId:666] [143389] (1 PDB entry)
    Uniprot Q9KTT6 2-67! Uniprot Q9KTT6 68-131
  8. 2954200Domain d1zvpa1: 1zvp A:2-67 [125714]
    Other proteins in same PDB: d1zvpc3

Details for d1zvpa1

PDB Entry: 1zvp (more details), 2.2 Å

PDB Description: Crystal Structure of a Protein of Unknown Function VC0802 from Vibrio cholerae, Possible Transport Protein
PDB Compounds: (A:) hypothetical protein VC0802

SCOPe Domain Sequences for d1zvpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvpa1 d.58.18.9 (A:2-67) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]}
sgikslelllqsmspelmagdyvfctvngalsdylslepiatfrepegltlvleaekaqq
agless

SCOPe Domain Coordinates for d1zvpa1:

Click to download the PDB-style file with coordinates for d1zvpa1.
(The format of our PDB-style files is described here.)

Timeline for d1zvpa1: