Lineage for d1zvob2 (1zvo B:110-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749548Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2749552Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2749633Domain d1zvob2: 1zvo B:110-214 [125713]
    Other proteins in same PDB: d1zvoa1, d1zvob1
    automatically matched to d1adql2

Details for d1zvob2

PDB Entry: 1zvo (more details)

PDB Description: semi-extended solution structure of human myeloma immunoglobulin d determined by constrained x-ray scattering
PDB Compounds: (B:) myeloma immunoglobulin D lambda

SCOPe Domain Sequences for d1zvob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvob2 b.1.1.2 (B:110-214) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d1zvob2:

Click to download the PDB-style file with coordinates for d1zvob2.
(The format of our PDB-style files is described here.)

Timeline for d1zvob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zvob1