Lineage for d1zvob1 (1zvo B:3-108)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653767Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 653844Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (5 PDB entries)
  8. 653853Domain d1zvob1: 1zvo B:3-108 [125712]
    Other proteins in same PDB: d1zvoa2, d1zvob2
    automatically matched to d1adql1

Details for d1zvob1

PDB Entry: 1zvo (more details)

PDB Description: semi-extended solution structure of human myeloma immunoglobulin d determined by constrained x-ray scattering
PDB Compounds: (B:) myeloma immunoglobulin D lambda

SCOP Domain Sequences for d1zvob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvob1 b.1.1.1 (B:3-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
vltqppsasgtpgqrvtiscfgsssnigryyvywyqqlpgttpklliykdnqrpsgvpdr
fsgsksgtsaslaisglrsedeadyycaawddslwvfgggttltvl

SCOP Domain Coordinates for d1zvob1:

Click to download the PDB-style file with coordinates for d1zvob1.
(The format of our PDB-style files is described here.)

Timeline for d1zvob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zvob2