Lineage for d1zvoa1 (1zvo A:3-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741692Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (8 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2741704Domain d1zvoa1: 1zvo A:3-108 [125710]
    Other proteins in same PDB: d1zvoa2, d1zvob2
    automatically matched to d1adql1

Details for d1zvoa1

PDB Entry: 1zvo (more details)

PDB Description: semi-extended solution structure of human myeloma immunoglobulin d determined by constrained x-ray scattering
PDB Compounds: (A:) myeloma immunoglobulin D lambda

SCOPe Domain Sequences for d1zvoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvoa1 b.1.1.1 (A:3-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
vltqppsasgtpgqrvtiscfgsssnigryyvywyqqlpgttpklliykdnqrpsgvpdr
fsgsksgtsaslaisglrsedeadyycaawddslwvfgggttltvl

SCOPe Domain Coordinates for d1zvoa1:

Click to download the PDB-style file with coordinates for d1zvoa1.
(The format of our PDB-style files is described here.)

Timeline for d1zvoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zvoa2