Lineage for d1zvlb2 (1zvl B:298-716)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003148Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 3003149Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 3003150Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 3003151Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 3003541Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (277 PDB entries)
    Uniprot P29476 298-716
  8. 3004090Domain d1zvlb2: 1zvl B:298-716 [125709]
    Other proteins in same PDB: d1zvla3, d1zvlb3
    automated match to d1qw6a_
    complexed with arg, h4b, hem, zn

Details for d1zvlb2

PDB Entry: 1zvl (more details), 2.5 Å

PDB Description: rat neuronal nitric oxide synthase oxygenase domain complexed with natural substrate l-arg.
PDB Compounds: (B:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1zvlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvlb2 d.174.1.1 (B:298-716) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
prflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpl
akefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvg
riqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwns
qliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqip
pelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrd
ycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsates
fikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOPe Domain Coordinates for d1zvlb2:

Click to download the PDB-style file with coordinates for d1zvlb2.
(The format of our PDB-style files is described here.)

Timeline for d1zvlb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zvlb3