SCOPe 2.06: Domain d1zvla2: 1zvl A:298-716

Lineage for d1zvla2 (1zvl A:298-716)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (235 PDB entries)
   Uniprot P29476 298-716

8. Domain d1zvla2: 1zvl A:298-716 [125708]
   Other proteins in same PDB: d1zvla3, d1zvlb3
   automated match to d1qw6a_
   complexed with arg, h4b, hem, zn

Details for d1zvla2

PDB Entry: 1zvl, 2.5 Å

PDB Description: rat neuronal nitric oxide synthase oxygenase domain complexed with natural substrate l-arg.

PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d1zvla2:

Sequence; same for both SEQRES and ATOM records:

>d1zvla2 d.174.1.1 (A:298-716) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
prflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpl
akefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvg
riqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwns
qliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqip
pelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrd
ycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsates
fikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Timeline for d1zvla2:

• d1zvla2 first appeared in SCOP 1.73, called d1zvla1
  
• d1zvla2 was called d1zvla_ in SCOPe 2.05
  
• d1zvla2 appears in SCOPe 2.07
  
• d1zvla2 appears in the current release, SCOPe 2.08