SCOP 1.73: Domain d1zvla1: 1zvl A:299-716

Lineage for d1zvla1 (1zvl A:299-716)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [82821] (31 PDB entries)

8. Domain d1zvla1: 1zvl A:299-716 [125708]
   automatically matched to d1om4b_
   complexed with arg, h4b, hem, zn

Details for d1zvla1

PDB Entry: 1zvl, 2.5 Å

PDB Description: rat neuronal nitric oxide synthase oxygenase domain complexed with natural substrate l-arg.

PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOP Domain Sequences for d1zvla1:

Sequence; same for both SEQRES and ATOM records:

>d1zvla1 d.174.1.1 (A:299-716) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Timeline for d1zvla1:

• d1zvla1 is new in SCOP 1.73
  
• d1zvla1 appears in SCOP 1.75
  
• d1zvla1 appears in the current release, SCOPe 2.08, called d1zvla2