![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
![]() | Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species) |
![]() | Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (4 PDB entries) Uniprot Q7WYN3 29-199 |
![]() | Domain d1zv9a_: 1zv9 A: [125700] automated match to d1qzna_ complexed with acy, edo, fmt, no3, pdo |
PDB Entry: 1zv9 (more details), 1.28 Å
SCOPe Domain Sequences for d1zv9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zv9a_ b.2.2.2 (A:) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]} aptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytks tmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvl keetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmikas
Timeline for d1zv9a_: