![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein BZZ1 [141188] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141189] (1 PDB entry) Uniprot P38822 497-552 |
![]() | Domain d1zuua1: 1zuu A:3-57 [125688] Other proteins in same PDB: d1zuua2 complexed with mg, unx |
PDB Entry: 1zuu (more details), 0.97 Å
SCOPe Domain Sequences for d1zuua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zuua1 b.34.2.1 (A:3-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nkvlyayvqkdddeititpgdkislvardtgsgwtkinndttgetglvpttyiri
Timeline for d1zuua1: