Lineage for d1zura_ (1zur A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2496244Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2496250Protein Phage T4 lysozyme [53982] (1 species)
  7. 2496251Species Bacteriophage T4 [TaxId:10665] [53983] (575 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2496300Domain d1zura_: 1zur A: [125687]
    automated match to d1zura1
    complexed with cl, r1f

Details for d1zura_

PDB Entry: 1zur (more details), 1.6 Å

PDB Description: Crystal structure of spin labeled T4 Lysozyme (V131R1F)
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1zura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zura_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaacnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d1zura_:

Click to download the PDB-style file with coordinates for d1zura_.
(The format of our PDB-style files is described here.)

Timeline for d1zura_: