Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries) |
Domain d1zuqa2: 1zuq A:84-198 [125684] Other proteins in same PDB: d1zuqa1, d1zuqb1 automated match to d2p4ka2 complexed with mn |
PDB Entry: 1zuq (more details), 2 Å
SCOPe Domain Sequences for d1zuqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zuqa2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d1zuqa2: