Lineage for d1zupa1 (1zup A:1-301)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124797Family c.55.3.11: TM1739-like [142505] (1 protein)
    Pfam PF04251; DUF430; particular similarity to the PIWI domain family
  6. 2124798Protein Hypothetical protein TM1739 [142506] (1 species)
  7. 2124799Species Thermotoga maritima [TaxId:2336] [142507] (1 PDB entry)
    Uniprot Q9X261 1-301
  8. 2124800Domain d1zupa1: 1zup A:1-301 [125681]
    Other proteins in same PDB: d1zupa2

Details for d1zupa1

PDB Entry: 1zup (more details), 2.2 Å

PDB Description: crystal structure of a putative nuclease with a ribonuclease h-like motif fold (tm1739) from thermotoga maritima at 2.20 a resolution
PDB Compounds: (A:) hypothetical protein TM1739

SCOPe Domain Sequences for d1zupa1:

Sequence, based on SEQRES records: (download)

>d1zupa1 c.55.3.11 (A:1-301) Hypothetical protein TM1739 {Thermotoga maritima [TaxId: 2336]}
mqvrieraerieseleehvgdqtfveesrfleedeqregeildqiifvdgkrrsfvritt
degitgifaelcvgaviwdreggtktlfspdkppvkervlgfsqsfqeegyeevggilfk
vvkegkdamqsidlymrsleieevrkhmdknilivkdgpaarelpfeenvgpiglvknig
vtelskedfkklrflkkgkrskmfvssretplkkvgayvklidgegirglvrletyvkdd
nqipyirkvfddlaktlphltadlpiprlpenilpiqfleenlsyyltdknymntrlfay
i

Sequence, based on observed residues (ATOM records): (download)

>d1zupa1 c.55.3.11 (A:1-301) Hypothetical protein TM1739 {Thermotoga maritima [TaxId: 2336]}
mqvrieraerieseleehvgdqtfveesrfleedeqregeildqiifvdgkrrsfvritt
degitgifaelcvgaviwdreggtktlfspdkppvkervlgfsqsfqeegyeevggilfk
vvkegkdamqsidlymrsleieevrkhmdknilivkdgpaarelpfeenvgpiglvknig
vtelskedfkklrflkkgkrskmfvsslkkvgayvklidgegirglvrletyvkddnqip
yirkvfddlaktlphltadlpnilpiqfleenlsyyltdknymntrlfayi

SCOPe Domain Coordinates for d1zupa1:

Click to download the PDB-style file with coordinates for d1zupa1.
(The format of our PDB-style files is described here.)

Timeline for d1zupa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zupa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zupb_