![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain [143068] (1 species) this proteins contains the N-terminal RWD domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143069] (1 PDB entry) Uniprot Q8WVN8 201-362 |
![]() | Domain d1zuoa1: 1zuo A:201-362 [125680] complexed with bme |
PDB Entry: 1zuo (more details), 1.8 Å
SCOPe Domain Sequences for d1zuoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gsvqasdrlmkelrdiyrsqsyktgiysvelindslydwhvklqkvdpdsplhsdlqilk ekegieyillnfsfkdnfpfdppfvrvvlpvlsggyvlgggalcmelltkqgwssaysie svimqinatlvkgkarvqfganknqynlaraqqsynsivqih
Timeline for d1zuoa1: