Lineage for d1zunb3 (1zun B:16-237)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111037Protein Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain [142269] (1 species)
  7. 2111038Species Pseudomonas syringae pv. tomato [TaxId:323] [142270] (1 PDB entry)
    Uniprot Q87WW1 16-237
  8. 2111039Domain d1zunb3: 1zun B:16-237 [125679]
    Other proteins in same PDB: d1zuna1, d1zuna2, d1zunb1, d1zunb2
    complexed with ags, gdp, mg, na

Details for d1zunb3

PDB Entry: 1zun (more details), 2.7 Å

PDB Description: Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae
PDB Compounds: (B:) sulfate adenylate transferase, subunit 1/adenylylsulfate kinase

SCOPe Domain Sequences for d1zunb3:

Sequence, based on SEQRES records: (download)

>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}
lgqherkemlrfltcgnvddgkstligrllhdskmiyedhleaitrdskksgttgddvdl
allvdglqaereqgitidvayryfstakrkfiiadtpgheqytrnmatgastcdlaiilv
darygvqtqtrrhsyiasllgikhivvainkmdlngfdervfesikadylkfaegiafkp
ttmafvpmsalkgdnvvnkserspwyagqslmeiletveias

Sequence, based on observed residues (ATOM records): (download)

>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}
lgqherkemlrfltcgnvddgkstligrllhdskmigddlallvdglqaitidvayryfs
takrkfiiadtpgheqytrnmatgastcdlaiilvdarygvqtqtrrhsyiasllgikhi
vvainkmdlngfdervfesikadylkfaegiafkpttmafvpmsalkgdnvvnkserspw
yagqslmeiletveias

SCOPe Domain Coordinates for d1zunb3:

Click to download the PDB-style file with coordinates for d1zunb3.
(The format of our PDB-style files is described here.)

Timeline for d1zunb3: