![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
![]() | Protein Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain [141345] (1 species) |
![]() | Species Pseudomonas syringae pv. tomato [TaxId:323] [141346] (1 PDB entry) |
![]() | Domain d1zunb2: 1zun B:330-434 [125678] Other proteins in same PDB: d1zuna1, d1zunb1, d1zunb3 complexed with ags, gdp, mg, na |
PDB Entry: 1zun (more details), 2.7 Å
SCOP Domain Sequences for d1zunb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} qvsdafdamlvwmaeepmlpgkkydikratsyvpgsiasithrvdvntleegpasslqln eigrvkvsldapialdgyssnrttgafividrltngtvaagmiia
Timeline for d1zunb2: