Lineage for d1zunb1 (1zun B:238-329)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402558Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2402733Protein Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain [141336] (1 species)
  7. 2402734Species Pseudomonas syringae pv. tomato [TaxId:323] [141337] (1 PDB entry)
    Uniprot Q87WW1 238-329
  8. 2402735Domain d1zunb1: 1zun B:238-329 [125677]
    Other proteins in same PDB: d1zuna1, d1zuna2, d1zunb2, d1zunb3
    complexed with ags, gdp, mg, na

Details for d1zunb1

PDB Entry: 1zun (more details), 2.7 Å

PDB Description: Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae
PDB Compounds: (B:) sulfate adenylate transferase, subunit 1/adenylylsulfate kinase

SCOPe Domain Sequences for d1zunb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}
drnytdlrfpvqyvnrpnlnfrgfagtlasgivhkgdeivvlpsgkssrvksivtfegel
eqagpgqavtltmedeidisrgdllvhadnvp

SCOPe Domain Coordinates for d1zunb1:

Click to download the PDB-style file with coordinates for d1zunb1.
(The format of our PDB-style files is described here.)

Timeline for d1zunb1: