SCOPe 2.08: Domain d1zunb1: 1zun B:238-329

Lineage for d1zunb1 (1zun B:238-329)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain [141336] (1 species)

7. Species Pseudomonas syringae pv. tomato [TaxId:323] [141337] (1 PDB entry)
   Uniprot Q87WW1 238-329

8. Domain d1zunb1: 1zun B:238-329 [125677]
   Other proteins in same PDB: d1zuna1, d1zuna2, d1zunb2, d1zunb3
   complexed with ags, gdp, mg, na

Details for d1zunb1

PDB Entry: 1zun, 2.7 Å

PDB Description: Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae

PDB Compounds: (B:) sulfate adenylate transferase, subunit 1/adenylylsulfate kinase

SCOPe Domain Sequences for d1zunb1:

Sequence; same for both SEQRES and ATOM records:

>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}
drnytdlrfpvqyvnrpnlnfrgfagtlasgivhkgdeivvlpsgkssrvksivtfegel
eqagpgqavtltmedeidisrgdllvhadnvp

Timeline for d1zunb1:

• d1zunb1 first appeared in SCOP 1.73
  
• d1zunb1 appears in SCOPe 2.07