SCOPe 2.05: Domain d1zuna1: 1zun A:1-211

Lineage for d1zuna1 (1zun A:1-211)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.2: PAPS reductase-like [52410] (2 proteins)

6. Protein Sulfate adenylyltransferase subunit 2, CysD [142089] (1 species)

7. Species Pseudomonas syringae pv. tomato [TaxId:323] [142090] (1 PDB entry)
   Uniprot Q87WW0 1-211

8. Domain d1zuna1: 1zun A:1-211 [125676]
   Other proteins in same PDB: d1zunb1, d1zunb2, d1zunb3
   complexed with ags, gdp, mg, na

Details for d1zuna1

PDB Entry: 1zun, 2.7 Å

PDB Description: Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae

PDB Compounds: (A:) Sulfate adenylyltransferase subunit 2

SCOPe Domain Sequences for d1zuna1:

Sequence, based on SEQRES records:

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]}
mvdklthlkqleaesihiirevaaefdnpvmlysigkdsavmlhlarkaffpgklpfpvm
hvdtrwkfqemyrfrdqmveemgldlithinpdgvaqginpfthgsakhtdimkteglkq
aldkhgfdaafggarrdeeksrakervysfrdskhrwdpknqrpelwnvyngnvnkgesi
rvfplsnwteldiwqyiylegipivplyfaa

Sequence, based on observed residues (ATOM records):

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]}
mvdklthlkqleaesihiirevaaefdnpvmlysigkdsavmlhlarkaffpgklpfpvm
hvdtrwkfqemyrfrdqmveemgldlithinsakhtdimkteglkqaldkhgfdaafgga
rrdeeksrakervysfrdskhrwdpknqrpelwnvyngnvnkgesirvfplsnwteldiw
qyiylegipivplyfaa

Timeline for d1zuna1:

• d1zuna1 first appeared in SCOP 1.73
  
• d1zuna1 appears in SCOPe 2.04
  
• d1zuna1 appears in SCOPe 2.06
  
• d1zuna1 appears in the current release, SCOPe 2.08