Lineage for d1zuna1 (1zun A:1-211)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591045Family c.26.2.2: PAPS reductase-like [52410] (2 proteins)
  6. 1591049Protein Sulfate adenylyltransferase subunit 2, CysD [142089] (1 species)
  7. 1591050Species Pseudomonas syringae pv. tomato [TaxId:323] [142090] (1 PDB entry)
    Uniprot Q87WW0 1-211
  8. 1591051Domain d1zuna1: 1zun A:1-211 [125676]
    Other proteins in same PDB: d1zunb1, d1zunb2, d1zunb3
    complexed with ags, gdp, mg, na

Details for d1zuna1

PDB Entry: 1zun (more details), 2.7 Å

PDB Description: Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae
PDB Compounds: (A:) Sulfate adenylyltransferase subunit 2

SCOPe Domain Sequences for d1zuna1:

Sequence, based on SEQRES records: (download)

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]}
mvdklthlkqleaesihiirevaaefdnpvmlysigkdsavmlhlarkaffpgklpfpvm
hvdtrwkfqemyrfrdqmveemgldlithinpdgvaqginpfthgsakhtdimkteglkq
aldkhgfdaafggarrdeeksrakervysfrdskhrwdpknqrpelwnvyngnvnkgesi
rvfplsnwteldiwqyiylegipivplyfaa

Sequence, based on observed residues (ATOM records): (download)

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]}
mvdklthlkqleaesihiirevaaefdnpvmlysigkdsavmlhlarkaffpgklpfpvm
hvdtrwkfqemyrfrdqmveemgldlithinsakhtdimkteglkqaldkhgfdaafgga
rrdeeksrakervysfrdskhrwdpknqrpelwnvyngnvnkgesirvfplsnwteldiw
qyiylegipivplyfaa

SCOPe Domain Coordinates for d1zuna1:

Click to download the PDB-style file with coordinates for d1zuna1.
(The format of our PDB-style files is described here.)

Timeline for d1zuna1: