![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.2: PAPS reductase-like [52410] (2 proteins) |
![]() | Protein Sulfate adenylyltransferase subunit 2, CysD [142089] (1 species) |
![]() | Species Pseudomonas syringae pv. tomato [TaxId:323] [142090] (1 PDB entry) Uniprot Q87WW0 1-211 |
![]() | Domain d1zuna1: 1zun A:1-211 [125676] Other proteins in same PDB: d1zuna2, d1zunb1, d1zunb2, d1zunb3 complexed with ags, gdp, mg, na |
PDB Entry: 1zun (more details), 2.7 Å
SCOPe Domain Sequences for d1zuna1:
Sequence, based on SEQRES records: (download)
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} mvdklthlkqleaesihiirevaaefdnpvmlysigkdsavmlhlarkaffpgklpfpvm hvdtrwkfqemyrfrdqmveemgldlithinpdgvaqginpfthgsakhtdimkteglkq aldkhgfdaafggarrdeeksrakervysfrdskhrwdpknqrpelwnvyngnvnkgesi rvfplsnwteldiwqyiylegipivplyfaa
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} mvdklthlkqleaesihiirevaaefdnpvmlysigkdsavmlhlarkaffpgklpfpvm hvdtrwkfqemyrfrdqmveemgldlithinsakhtdimkteglkqaldkhgfdaafgga rrdeeksrakervysfrdskhrwdpknqrpelwnvyngnvnkgesirvfplsnwteldiw qyiylegipivplyfaa
Timeline for d1zuna1: