Lineage for d1zuca_ (1zuc A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923809Protein Progesterone receptor [48517] (1 species)
  7. 923810Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries)
    Uniprot P06401 679-932
  8. 923817Domain d1zuca_: 1zuc A: [125666]
    automated match to d1a28a_
    complexed with so4, t98

Details for d1zuca_

PDB Entry: 1zuc (more details), 2 Å

PDB Description: Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist tanaproget
PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d1zuca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zuca_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

SCOPe Domain Coordinates for d1zuca_:

Click to download the PDB-style file with coordinates for d1zuca_.
(The format of our PDB-style files is described here.)

Timeline for d1zuca_: