Lineage for d1zuba1 (1zub A:597-705)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666725Protein Regulating synaptic membrane exocytosis protein 1, RIMS1 [141279] (2 species)
  7. 666728Species Rat (Rattus norvegicus) [TaxId:10116] [141280] (1 PDB entry)
  8. 666729Domain d1zuba1: 1zub A:597-705 [125665]

Details for d1zuba1

PDB Entry: 1zub (more details)

PDB Description: Solution Structure of the RIM1alpha PDZ Domain in Complex with an ELKS1b C-terminal Peptide
PDB Compounds: (A:) Regulating synaptic membrane exocytosis protein 1

SCOP Domain Sequences for d1zuba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zuba1 b.36.1.1 (A:597-705) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Rat (Rattus norvegicus) [TaxId: 10116]}
hpvtwqpskegdrligrvilnkrttmpkesgallglkvvggkmtdlgrlgafitkvkkgs
ladvvghlragdevlewngkplpgatneevyniilesksepqveiivsr

SCOP Domain Coordinates for d1zuba1:

Click to download the PDB-style file with coordinates for d1zuba1.
(The format of our PDB-style files is described here.)

Timeline for d1zuba1: