Lineage for d1zu2a1 (1zu2 A:1-145)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647285Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
  6. 647321Protein Mitochondrial import receptor subunit tom20-3 [140839] (1 species)
  7. 647322Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [140840] (1 PDB entry)
  8. 647323Domain d1zu2a1: 1zu2 A:1-145 [125662]

Details for d1zu2a1

PDB Entry: 1zu2 (more details)

PDB Description: Solution NMR structure of the plant Tom20 mitochondrial import receptor from Arabidopsis thaliana
PDB Compounds: (A:) Mitochondrial import receptor subunit TOM20-3

SCOP Domain Sequences for d1zu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mdtetefdrillfeqirqdaentyksnpldadnltrwggvllelsqfhsisdakqmiqea
itkfeeallidpkkdeavwcignaytsfafltpdeteakhnfdlatqffqqavdeqpdnt
hylkslemtakapqlhaeaykqglg

SCOP Domain Coordinates for d1zu2a1:

Click to download the PDB-style file with coordinates for d1zu2a1.
(The format of our PDB-style files is described here.)

Timeline for d1zu2a1: