SCOPe 2.08: Domain d1zu2a1: 1zu2 A:1-145

Lineage for d1zu2a1 (1zu2 A:1-145)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Mitochondrial import receptor subunit tom20-3 [140839] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [140840] (1 PDB entry)
   Uniprot P82874 1-145

8. Domain d1zu2a1: 1zu2 A:1-145 [125662]
   Other proteins in same PDB: d1zu2a2, d1zu2a3

Details for d1zu2a1

PDB Entry: 1zu2

PDB Description: solution nmr structure of the plant tom20 mitochondrial import receptor from arabidopsis thaliana

PDB Compounds: (A:) Mitochondrial import receptor subunit TOM20-3

SCOPe Domain Sequences for d1zu2a1:

Sequence; same for both SEQRES and ATOM records:

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mdtetefdrillfeqirqdaentyksnpldadnltrwggvllelsqfhsisdakqmiqea
itkfeeallidpkkdeavwcignaytsfafltpdeteakhnfdlatqffqqavdeqpdnt
hylkslemtakapqlhaeaykqglg

Timeline for d1zu2a1:

• d1zu2a1 first appeared in SCOP 1.73
  
• d1zu2a1 appears in SCOPe 2.07