![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) |
![]() | Protein Envelope glycoprotein [49213] (5 species) |
![]() | Species West Nile virus [TaxId:11082] [110056] (2 PDB entries) |
![]() | Domain d1ztxe1: 1ztx E:300-400 [125658] Other proteins in same PDB: d1ztxh1 automatically matched to d1s6na_ |
PDB Entry: 1ztx (more details), 2.5 Å
SCOP Domain Sequences for d1ztxe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztxe1 b.1.18.4 (E:300-400) Envelope glycoprotein {West Nile virus [TaxId: 11082]} ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks
Timeline for d1ztxe1: