SCOP 1.73: Domain d1ztxe1: 1ztx E:300-400

Lineage for d1ztxe1 (1ztx E:300-400)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species West Nile virus [TaxId:11082] [110056] (2 PDB entries)

8. Domain d1ztxe1: 1ztx E:300-400 [125658]
   Other proteins in same PDB: d1ztxh1
   automatically matched to d1s6na_

Details for d1ztxe1

PDB Entry: 1ztx, 2.5 Å

PDB Description: West Nile Virus Envelope Protein DIII in complex with neutralizing E16 antibody Fab

PDB Compounds: (E:) envelope protein

SCOP Domain Sequences for d1ztxe1:

Sequence; same for both SEQRES and ATOM records:

>d1ztxe1 b.1.18.4 (E:300-400) Envelope glycoprotein {West Nile virus [TaxId: 11082]}
ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn
pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

Timeline for d1ztxe1:

• d1ztxe1 is new in SCOP 1.73
  
• d1ztxe1 appears in SCOP 1.75
  
• d1ztxe1 appears in the current release, SCOPe 2.08, called d1ztxe_