Lineage for d1ztwa_ (1ztw A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622423Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2622875Protein MMLV reverse transcriptase [56687] (1 species)
  7. 2622876Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
    Uniprot P03355 RE 144-594
  8. 2622878Domain d1ztwa_: 1ztw A: [125657]
    automated match to d1d0eb_
    protein/DNA complex

Details for d1ztwa_

PDB Entry: 1ztw (more details), 1.8 Å

PDB Description: d(cttaattcgaattaag) complexed with moloney murine leukemia virus reverse transcriptase catalytic fragment
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1ztwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztwa_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

SCOPe Domain Coordinates for d1ztwa_:

Click to download the PDB-style file with coordinates for d1ztwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ztwa_: