Lineage for d1ztwa1 (1ztw A:24-278)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743176Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 743368Protein MMLV reverse transcriptase [56687] (1 species)
  7. 743369Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (18 PDB entries)
  8. 743372Domain d1ztwa1: 1ztw A:24-278 [125657]
    automatically matched to d1d0ea_

Details for d1ztwa1

PDB Entry: 1ztw (more details), 1.8 Å

PDB Description: d(cttaattcgaattaag) complexed with moloney murine leukemia virus reverse transcriptase catalytic fragment
PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d1ztwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztwa1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

SCOP Domain Coordinates for d1ztwa1:

Click to download the PDB-style file with coordinates for d1ztwa1.
(The format of our PDB-style files is described here.)

Timeline for d1ztwa1: