Lineage for d1ztta1 (1ztt A:24-278)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884437Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 884660Protein MMLV reverse transcriptase [56687] (1 species)
  7. 884661Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
    Uniprot P03355 RE 144-594
  8. 884664Domain d1ztta1: 1ztt A:24-278 [125656]
    automatically matched to d1d0ea_
    complexed with nt

Details for d1ztta1

PDB Entry: 1ztt (more details), 1.85 Å

PDB Description: netropsin bound to d(cttaattcgaattaag) in complex with mmlv rt catalytic fragment
PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d1ztta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztta1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

SCOP Domain Coordinates for d1ztta1:

Click to download the PDB-style file with coordinates for d1ztta1.
(The format of our PDB-style files is described here.)

Timeline for d1ztta1: