SCOP 1.73: Domain d1ztpb1: 1ztp B:17-250

Lineage for d1ztpb1 (1ztp B:17-250)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (2 families)

5. Family d.86.1.2: BLES03-like [143583] (1 protein)
   the N-terminal strand is missing, but there extra C-terminal strands in the beta-sheet

6. Protein Basophilic leukemia expressed protein BLES03 [143584] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143585] (2 PDB entries)

8. Domain d1ztpb1: 1ztp B:17-250 [125650]
   automatically matched to 1ZTP A:17-250

Details for d1ztpb1

PDB Entry: 1ztp, 2.5 Å

PDB Description: x-ray structure of gene product from homo sapiens hs.433573

PDB Compounds: (B:) Basophilic leukemia expressed protein BLES03

SCOP Domain Sequences for d1ztpb1:

Sequence; same for both SEQRES and ATOM records:

>d1ztpb1 d.86.1.2 (B:17-250) Basophilic leukemia expressed protein BLES03 {Human (Homo sapiens) [TaxId: 9606]}
edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
ikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsrvldrannvel

Timeline for d1ztpb1:

• d1ztpb1 is new in SCOP 1.73
  
• d1ztpb1 appears in SCOP 1.75
  
• d1ztpb1 appears in the current release, SCOPe 2.08, called d1ztpb_